Name | TEC antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4469 |
Prices | $375.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | TEC antibody was raised using the middle region of TEC corresponding to a region with amino acids VKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFG |
Purity/Format | Affinity purified |
Blocking Peptide | TEC Blocking Peptide |
Description | Rabbit polyclonal TEC antibody raised against the middle region of TEC |
Gene | TEC |
Supplier Page | Shop |