| Name | TEC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4469 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TEC antibody was raised using the middle region of TEC corresponding to a region with amino acids VKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFG |
| Purity/Format | Affinity purified |
| Blocking Peptide | TEC Blocking Peptide |
| Description | Rabbit polyclonal TEC antibody raised against the middle region of TEC |
| Gene | TEC |
| Supplier Page | Shop |