DPH1 antibody

Name DPH1 antibody
Supplier Fitzgerald
Catalog 70R-4122
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV
Purity/Format Affinity purified
Blocking Peptide DPH1 Blocking Peptide
Description Rabbit polyclonal DPH1 antibody
Gene DPH1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.