| Name | GNAS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5756 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD |
| Purity/Format | Affinity purified |
| Blocking Peptide | GNAS Blocking Peptide |
| Description | Rabbit polyclonal GNAS antibody raised against the N terminal of GNAS |
| Gene | GNAS |
| Supplier Page | Shop |