| Name | TRPM5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5146 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRPM5 Blocking Peptide |
| Description | Rabbit polyclonal TRPM5 antibody raised against the N terminal of TRPM5 |
| Gene | TRPM5 |
| Supplier Page | Shop |