Name | TRPM5 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5146 |
Prices | $375.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV |
Purity/Format | Affinity purified |
Blocking Peptide | TRPM5 Blocking Peptide |
Description | Rabbit polyclonal TRPM5 antibody raised against the N terminal of TRPM5 |
Gene | TRPM5 |
Supplier Page | Shop |