FKBP8 antibody

Name FKBP8 antibody
Supplier Fitzgerald
Catalog 70R-5950
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen FKBP8 antibody was raised using the N terminal of FKBP8 corresponding to a region with amino acids GPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLS
Purity/Format Affinity purified
Blocking Peptide FKBP8 Blocking Peptide
Description Rabbit polyclonal FKBP8 antibody raised against the N terminal of FKBP8
Gene FKBP8
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.