| Name | FLJ90709 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7082 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FLJ90709 antibody was raised using the middle region of Flj90709 corresponding to a region with amino acids VLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNS |
| Purity/Format | Affinity purified |
| Blocking Peptide | FLJ90709 Blocking Peptide |
| Description | Rabbit polyclonal FLJ90709 antibody raised against the middle region of Flj90709 |
| Gene | SLC38A9 |
| Supplier Page | Shop |