CHST6 antibody

Name CHST6 antibody
Supplier Fitzgerald
Catalog 70R-5372
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CHST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN
Purity/Format Affinity purified
Blocking Peptide CHST6 Blocking Peptide
Description Rabbit polyclonal CHST6 antibody
Gene CHST6
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.