Name | UBE2L3 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1044 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human |
Antigen | UBE2L3 antibody was raised using the C terminal of UBE2L3 corresponding to a region with amino acids TDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEK |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | UBE2L3 Blocking Peptide |
Description | Rabbit polyclonal UBE2L3 antibody raised against the C terminal of UBE2L3 |
Gene | UBE2L3 |
Supplier Page | Shop |