Name | ASGR1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1076 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Dog |
Antigen | ASGR1 antibody was raised using the N terminal of ASGR1 corresponding to a region with amino acids RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | ASGR1 Blocking Peptide |
Description | Rabbit polyclonal ASGR1 antibody raised against the N terminal of ASGR1 |
Gene | ASGR1 |
Supplier Page | Shop |