| Name | TMEM173 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2359 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TMEM173 antibody was raised using the middle region of TMEM173 corresponding to a region with amino acids DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPL |
| Purity/Format | Affinity purified |
| Blocking Peptide | TMEM173 Blocking Peptide |
| Description | Rabbit polyclonal TMEM173 antibody raised against the middle region of TMEM173 |
| Gene | TMEM173 |
| Supplier Page | Shop |