| Name | GPCR5A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6472 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | GPCR5A antibody was raised using the C terminal Of Gpcr5A corresponding to a region with amino acids SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY |
| Purity/Format | Affinity purified |
| Blocking Peptide | GPCR5A Blocking Peptide |
| Description | Rabbit polyclonal GPCR5A antibody raised against the C terminal Of Gpcr5A |
| Gene | GPRC5A |
| Supplier Page | Shop |