KCNQ2 antibody

Name KCNQ2 antibody
Supplier Fitzgerald
Catalog 70R-1525
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI
Purity/Format Total IgG Protein A purified
Blocking Peptide KCNQ2 Blocking Peptide
Description Rabbit polyclonal KCNQ2 antibody raised against the middle region of KCNQ2
Gene KCNQ2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.