| Name | LARGE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6856 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE |
| Purity/Format | Affinity purified |
| Blocking Peptide | LARGE Blocking Peptide |
| Description | Rabbit polyclonal LARGE antibody raised against the middle region of LARGE |
| Gene | LARGE |
| Supplier Page | Shop |