Name | MCM7 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5569 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | MCM7 antibody was raised using the middle region of MCM7 corresponding to a region with amino acids LSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVI |
Purity/Format | Affinity purified |
Blocking Peptide | MCM7 Blocking Peptide |
Description | Rabbit polyclonal MCM7 antibody raised against the middle region of MCM7 |
Gene | MCM7 |
Supplier Page | Shop |