| Name | NAGS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1562 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | NAGS Blocking Peptide |
| Description | Rabbit polyclonal NAGS antibody raised against the C terminal of NAGS |
| Gene | NAGS |
| Supplier Page | Shop |