Name | RSAD2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1595 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | RSAD2 antibody was raised using the N terminal of RSAD2 corresponding to a region with amino acids PLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLP |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | RSAD2 Blocking Peptide |
Description | Rabbit polyclonal RSAD2 antibody raised against the N terminal of RSAD2 |
Gene | RSAD2 |
Supplier Page | Shop |