| Name | ARSA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2332 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ARSA antibody was raised using the middle region of ARSA corresponding to a region with amino acids KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH |
| Purity/Format | Affinity purified |
| Blocking Peptide | ARSA Blocking Peptide |
| Description | Rabbit polyclonal ARSA antibody raised against the middle region of ARSA |
| Gene | DEGS1 |
| Supplier Page | Shop |