Name | LST-3TM12 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6381 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | LST-3TM12 antibody was raised using the middle region of LST-3TM12 corresponding to a region with amino acids RAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLE |
Purity/Format | Affinity purified |
Blocking Peptide | LST-3TM12 Blocking Peptide |
Description | Rabbit polyclonal LST-3TM12 antibody raised against the middle region of LST-3TM12 |
Gene | SLCO1B3 |
Supplier Page | Shop |