| Name | LST-3TM12 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6381 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LST-3TM12 antibody was raised using the middle region of LST-3TM12 corresponding to a region with amino acids RAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLE |
| Purity/Format | Affinity purified |
| Blocking Peptide | LST-3TM12 Blocking Peptide |
| Description | Rabbit polyclonal LST-3TM12 antibody raised against the middle region of LST-3TM12 |
| Gene | SLCO1B3 |
| Supplier Page | Shop |