| Name | LTC4S antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1852 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LTC4S antibody was raised using the N terminal of LTC4S corresponding to a region with amino acids MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY |
| Purity/Format | Affinity purified |
| Description | Affinity purified rabbit polyclonal LTC4S antibody raised against the N terminal of LTC4S |
| Gene | LTC4S |
| Supplier Page | Shop |