| Name | CLIC4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1498 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CLIC4 Blocking Peptide |
| Description | Rabbit polyclonal CLIC4 antibody raised against the N terminal of CLIC4 |
| Gene | CLIC4 |
| Supplier Page | Shop |