ITGB3BP antibody

Name ITGB3BP antibody
Supplier Fitzgerald
Catalog 70R-6093
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ITGB3BP antibody was raised using a synthetic peptide corresponding to a region with amino acids TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE
Purity/Format Affinity purified
Blocking Peptide ITGB3BP Blocking Peptide
Description Rabbit polyclonal ITGB3BP antibody
Gene ITGB3BP
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.