| Name | TERF2IP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4063 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TERF2IP antibody was raised using the middle region of TERF2IP corresponding to a region with amino acids EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV |
| Purity/Format | Affinity purified |
| Blocking Peptide | TERF2IP Blocking Peptide |
| Description | Rabbit polyclonal TERF2IP antibody raised against the middle region of TERF2IP |
| Gene | TERF2IP |
| Supplier Page | Shop |