| Name | ALAS1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2428 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ALAS1 antibody was raised using the N terminal of ALAS1 corresponding to a region with amino acids ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS |
| Purity/Format | Affinity purified |
| Blocking Peptide | ALAS1 Blocking Peptide |
| Description | Rabbit polyclonal ALAS1 antibody raised against the N terminal of ALAS1 |
| Gene | ALAS1 |
| Supplier Page | Shop |