| Name | IREB2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4991 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | IREB2 antibody was raised using the middle region of IREB2 corresponding to a region with amino acids IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK |
| Purity/Format | Affinity purified |
| Blocking Peptide | IREB2 Blocking Peptide |
| Description | Rabbit polyclonal IREB2 antibody raised against the middle region of IREB2 |
| Gene | IREB2 |
| Supplier Page | Shop |