| Name | CHGN antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6125 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | CHGN antibody was raised using the C terminal Of Chgn corresponding to a region with amino acids DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT |
| Purity/Format | Affinity purified |
| Blocking Peptide | CHGN Blocking Peptide |
| Description | Rabbit polyclonal CHGN antibody raised against the C terminal Of Chgn |
| Gene | CSGALNACT1 |
| Supplier Page | Shop |