Name | Ligatin antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4831 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Ligatin antibody was raised using the middle region of LGTN corresponding to a region with amino acids KVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQ |
Purity/Format | Affinity purified |
Blocking Peptide | Ligatin Blocking Peptide |
Description | Rabbit polyclonal Ligatin antibody raised against the middle region of LGTN |
Gene | EIF2D |
Supplier Page | Shop |