| Name | Ligatin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4831 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Ligatin antibody was raised using the middle region of LGTN corresponding to a region with amino acids KVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | Ligatin Blocking Peptide |
| Description | Rabbit polyclonal Ligatin antibody raised against the middle region of LGTN |
| Gene | EIF2D |
| Supplier Page | Shop |