| Name | ALPPL2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5382 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ALPPL2 antibody was raised using the middle region of ALPPL2 corresponding to a region with amino acids SESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV |
| Purity/Format | Affinity purified |
| Blocking Peptide | ALPPL2 Blocking Peptide |
| Description | Rabbit polyclonal ALPPL2 antibody raised against the middle region of ALPPL2 |
| Gene | GUCA1A |
| Supplier Page | Shop |