| Name | LCK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2658 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | LCK antibody was raised using the N terminal of LCK corresponding to a region with amino acids PSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLE |
| Purity/Format | Affinity purified |
| Blocking Peptide | LCK Blocking Peptide |
| Description | Rabbit polyclonal LCK antibody raised against the N terminal of LCK |
| Gene | LCK |
| Supplier Page | Shop |