| Name | BRI3BP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7252 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | BRI3BP antibody was raised using the C terminal of BRI3BP corresponding to a region with amino acids GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK |
| Purity/Format | Affinity purified |
| Blocking Peptide | BRI3BP Blocking Peptide |
| Description | Rabbit polyclonal BRI3BP antibody raised against the C terminal of BRI3BP |
| Gene | LETMD1 |
| Supplier Page | Shop |