| Name | PPP4R2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3940 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PPP4R2 antibody was raised using the C terminal of PPP4R2 corresponding to a region with amino acids DSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNE |
| Purity/Format | Affinity purified |
| Blocking Peptide | PPP4R2 Blocking Peptide |
| Description | Rabbit polyclonal PPP4R2 antibody raised against the C terminal of PPP4R2 |
| Gene | PPP4R2 |
| Supplier Page | Shop |