| Name | Copine I antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1407 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | Copine I antibody was raised using the N terminal of CPNE1 corresponding to a region with amino acids TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | Copine I Blocking Peptide |
| Description | Rabbit polyclonal Copine I antibody raised against the N terminal of CPNE1 |
| Gene | CYP11B1 |
| Supplier Page | Shop |