| Name | ALOX12 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3235 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ALOX12 antibody was raised using the C terminal of ALOX12 corresponding to a region with amino acids MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF |
| Purity/Format | Affinity purified |
| Blocking Peptide | ALOX12 Blocking Peptide |
| Description | Rabbit polyclonal ALOX12 antibody raised against the C terminal of ALOX12 |
| Gene | ALOX12 |
| Supplier Page | Shop |