Name | RRAD antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5798 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | RRAD antibody was raised using the middle region of RRAD corresponding to a region with amino acids YDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQ |
Purity/Format | Affinity purified |
Blocking Peptide | RRAD Blocking Peptide |
Description | Rabbit polyclonal RRAD antibody raised against the middle region of RRAD |
Gene | RRAD |
Supplier Page | Shop |