| Name | EXOSC6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1439 |
| Prices | $315.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | EXOSC6 antibody was raised using the N terminal of EXOSC6 corresponding to a region with amino acids MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | EXOSC6 Blocking Peptide |
| Description | Rabbit polyclonal EXOSC6 antibody raised against the N terminal of EXOSC6 |
| Gene | EXOSC6 |
| Supplier Page | Shop |