Name | PENK antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6226 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | PENK antibody was raised using the middle region of PENK corresponding to a region with amino acids DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG |
Purity/Format | Affinity purified |
Blocking Peptide | PENK Blocking Peptide |
Description | Rabbit polyclonal PENK antibody raised against the middle region of PENK |
Gene | PENK |
Supplier Page | Shop |