| Name | HDAC9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1632 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | HDAC9 antibody was raised using the C terminal of HDAC9 corresponding to a region with amino acids QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | HDAC9 Blocking Peptide |
| Description | Rabbit polyclonal HDAC9 antibody raised against the C terminal of HDAC9 |
| Gene | HDAC9 |
| Supplier Page | Shop |