| Name | MOGAT2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6418 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MOGAT2 antibody was raised using the middle region of MOGAT2 corresponding to a region with amino acids LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN |
| Purity/Format | Affinity purified |
| Blocking Peptide | MOGAT2 Blocking Peptide |
| Description | Rabbit polyclonal MOGAT2 antibody raised against the middle region of MOGAT2 |
| Gene | MOGAT2 |
| Supplier Page | Shop |