Name | ADA antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5862 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ADA antibody was raised using the N terminal of ADA corresponding to a region with amino acids AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA |
Purity/Format | Affinity purified |
Blocking Peptide | ADA Blocking Peptide |
Description | Rabbit polyclonal ADA antibody raised against the N terminal of ADA |
Gene | ADA |
Supplier Page | Shop |