Tetraspanin 12 antibody

Name Tetraspanin 12 antibody
Supplier Fitzgerald
Catalog 70R-7188
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen Tetraspanin 12 antibody was raised using the middle region of TSPAN12 corresponding to a region with amino acids EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ
Purity/Format Affinity purified
Blocking Peptide Tetraspanin 12 Blocking Peptide
Description Rabbit polyclonal Tetraspanin 12 antibody raised against the middle region of TSPAN12
Gene TSPAN12
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.