Name | Tetraspanin 12 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7188 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | Tetraspanin 12 antibody was raised using the middle region of TSPAN12 corresponding to a region with amino acids EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ |
Purity/Format | Affinity purified |
Blocking Peptide | Tetraspanin 12 Blocking Peptide |
Description | Rabbit polyclonal Tetraspanin 12 antibody raised against the middle region of TSPAN12 |
Gene | TSPAN12 |
Supplier Page | Shop |