| Name | FICD antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5702 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | FICD antibody was raised using the C terminal of FICD corresponding to a region with amino acids GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP |
| Purity/Format | Affinity purified |
| Blocking Peptide | FICD Blocking Peptide |
| Description | Rabbit polyclonal FICD antibody raised against the C terminal of FICD |
| Gene | FICD |
| Supplier Page | Shop |