| Name | C19ORF46 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6674 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C19ORF46 antibody was raised using the N terminal Of C19Orf46 corresponding to a region with amino acids GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA |
| Purity/Format | Affinity purified |
| Blocking Peptide | C19ORF46 Blocking Peptide |
| Description | Rabbit polyclonal C19ORF46 antibody raised against the N terminal Of C19Orf46 |
| Gene | SYNE4 |
| Supplier Page | Shop |