| Name | SCP2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3015 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | SCP2 antibody was raised using the middle region of SCP2 corresponding to a region with amino acids NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA |
| Purity/Format | Affinity purified |
| Blocking Peptide | SCP2 Blocking Peptide |
| Description | Rabbit polyclonal SCP2 antibody raised against the middle region of SCP2 |
| Gene | CTDSP2 |
| Supplier Page | Shop |