| Name | NNT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6519 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | NNT antibody was raised using the N terminal of NNT corresponding to a region with amino acids IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM |
| Purity/Format | Affinity purified |
| Blocking Peptide | NNT Blocking Peptide |
| Description | Rabbit polyclonal NNT antibody raised against the N terminal of NNT |
| Gene | NNT |
| Supplier Page | Shop |