UGT1A4 antibody

Name UGT1A4 antibody
Supplier Fitzgerald
Catalog 70R-7257
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen UGT1A4 antibody was raised using the N terminal of UGT1A4 corresponding to a region with amino acids VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK
Purity/Format Affinity purified
Blocking Peptide UGT1A4 Blocking Peptide
Description Rabbit polyclonal UGT1A4 antibody raised against the N terminal of UGT1A4
Gene UGT1A4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.