| Name | SH2D3C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5771 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SH2D3C antibody was raised using the N terminal of SH2D3C corresponding to a region with amino acids AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE |
| Purity/Format | Affinity purified |
| Blocking Peptide | SH2D3C Blocking Peptide |
| Description | Rabbit polyclonal SH2D3C antibody raised against the N terminal of SH2D3C |
| Gene | SH2D3C |
| Supplier Page | Shop |