| Name | EDG8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1766 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Drosophila, Zebrafish |
| Antigen | EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | EDG8 Blocking Peptide |
| Description | Rabbit polyclonal EDG8 antibody raised against the N terminal of EDG8 |
| Gene | S1PR5 |
| Supplier Page | Shop |