EDG8 antibody

Name EDG8 antibody
Supplier Fitzgerald
Catalog 70R-1766
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Mouse, Rat, Dog, Drosophila, Zebrafish
Antigen EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI
Purity/Format Total IgG Protein A purified
Blocking Peptide EDG8 Blocking Peptide
Description Rabbit polyclonal EDG8 antibody raised against the N terminal of EDG8
Gene S1PR5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.