| Name | DLAT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2503 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, C. elegans |
| Antigen | DLAT antibody was raised using the C terminal of DLAT corresponding to a region with amino acids DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA |
| Purity/Format | Affinity purified |
| Blocking Peptide | DLAT Blocking Peptide |
| Description | Rabbit polyclonal DLAT antibody raised against the C terminal of DLAT |
| Gene | DLAT |
| Supplier Page | Shop |