| Name | IPPK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3497 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | IPPK antibody was raised using the middle region of IPPK corresponding to a region with amino acids KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK |
| Purity/Format | Affinity purified |
| Blocking Peptide | IPPK Blocking Peptide |
| Description | Rabbit polyclonal IPPK antibody raised against the middle region of IPPK |
| Gene | IPPK |
| Supplier Page | Shop |