| Name | MAP2K7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2695 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MAP2K7 antibody was raised using the middle region of MAP2K7 corresponding to a region with amino acids ERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVL |
| Purity/Format | Affinity purified |
| Blocking Peptide | MAP2K7 Blocking Peptide |
| Description | Rabbit polyclonal MAP2K7 antibody raised against the middle region of MAP2K7 |
| Gene | METAP2 |
| Supplier Page | Shop |