ARHGDIG antibody

Name ARHGDIG antibody
Supplier Fitzgerald
Catalog 70R-6038
Prices $375.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ARHGDIG antibody was raised using a synthetic peptide corresponding to a region with amino acids DEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPN
Purity/Format Affinity purified
Blocking Peptide ARHGDIG Blocking Peptide
Description Rabbit polyclonal ARHGDIG antibody
Gene ARHGDIG
Supplier Page Shop